PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan016638
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family EIL
Protein Properties Length: 254aa    MW: 28802.9 Da    PI: 9.4822
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-131140PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3372.47.4e-114362531224
                XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
       EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekve 100
                eel++rmwkd+++lkrlke++k l    ++a++++k +++++qarrkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+g+sd+LraWWkekv+
  Aan016638  36 EELERRMWKDRIKLKRLKEKQKILA---QQAAEKQKAKQTSDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGSSDNLRAWWKEKVK 132
                8*******************99864...4458999***************************************************************** PP

                XXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG CS
       EIN3 101 fdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkphd 200
                fd+ngpaai+ky+a++++ +++ ++  ++ + ++ l++lqD+tlgSLLs+lmqhcdppqr+fplekg++pPWWPtG+e+ww +lgl+k q+ ppykkphd
  Aan016638 133 FDKNGPAAIAKYDADCIAKGQGAGC--QNGNPNSILQDLQDATLGSLLSSLMQHCDPPQRKFPLEKGLPPPWWPTGDEDWWTRLGLPKGQS-PPYKKPHD 229
                ****************999999999..56888899********************************************************.9******* PP

                --HHHHHHHHHHHHHHTGGGHHHH CS
       EIN3 201 lkkawkvsvLtavikhmsptieei 224
                lkk+wkv+vLtavikhmsp+i++i
  Aan016638 230 LKKMWKVGVLTAVIKHMSPNIAKI 253
                *********************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.2E-11336253No hitNo description
Gene3DG3DSA:1.10.3180.101.9E-52163253IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.44E-46165253IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MDDYMIDTNG LNDNSDIEGD DNIAEKDVSD EEIEPEELER RMWKDRIKLK RLKEKQKILA  60
QQAAEKQKAK QTSDQARRKK MSRAQDGILK YMLKLMEVCK ARGFVYGIIP EKGKPVSGSS  120
DNLRAWWKEK VKFDKNGPAA IAKYDADCIA KGQGAGCQNG NPNSILQDLQ DATLGSLLSS  180
LMQHCDPPQR KFPLEKGLPP PWWPTGDEDW WTRLGLPKGQ SPPYKKPHDL KKMWKVGVLT  240
AVIKHMSPNI AKIX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A2e-531652531199ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009788577.11e-156PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X1
RefseqXP_016465525.11e-156PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231161e-133EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A0V0IUK51e-155A0A0V0IUK5_SOLCH; Putative ETHYLENE INSENSITIVE 3-like 3 protein-like
STRINGPGSC0003DMT4000768901e-154(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-121ETHYLENE-INSENSITIVE3-like 3